SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070506 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070506
Domain Number 1 Region: 37-100
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000424
Family Variant RING domain 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0070506
Domain Number - Region: 122-285
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0209
Family ABC transporter transmembrane region 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070506   Gene: FBgn0029661   Transcript: FBtr0070530
Sequence length 383
Comment pep:known chromosome:BDGP5:X:3356507:3358077:-1 gene:FBgn0029661 transcript:FBtr0070530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSNQEIYFQPRYHMEMRGSGGSNPLSQHSELSNADGERICWICFATSEDNPHAHWVQPC
QCRGDTKWVHQSCLYRWIDEKQLGDRRQTVICQQCQTEYIMVFPQMNPIARVLEKLDYAV
RRICPFLVLGMFLCCIYWIALTYGAFTIIQVVGQDRAMQLMENKVILLVGLPFIPVGLIL
FRLVRWKDAVLKAMRSIYIYIPRKLPFFHRTNQSEGASRDLGDLGDLDDLSVSSSSSISL
PPIQHNPSITEPFYISRLICGAFFLPTFATTVGNVFFGRLDDALQRTILGGIAYIGIKGL
LKMYLDQKLYLRRLGRCILNYTDENVRMIDQHTQDNSNYNPNQGSNDDDRQFAGFNESID
DSFSVHTTDSAVGDASSIQIVVQ
Download sequence
Identical sequences Q9W4S2
NP_570059.2.81976 7227.FBpp0070506 FBpp0070506 FBpp0070506 FBpp0070506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]