SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070521 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070521
Domain Number 1 Region: 26-78
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000283
Family ZZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070521   Gene: FBgn0040355   Transcript: FBtr0070546
Sequence length 229
Comment pep:known chromosome:BDGP5:X:2787120:2788265:1 gene:FBgn0040355 transcript:FBtr0070546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINYRTHELSGSPSMPRRRQIGHTSGHCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSDCK
ENGVSNGLHSLDHPLQCLMDRDALELHFAGEPIPILCADSFTCPVCGEMGFSVEDLRTHC
QDNHRMARTVCICPVCAAVPLSQPSHIAHIANHLMFSPSHRATGDPMIDISATSQAEGSS
LPQNSAVSSGSGAQHTFSSSENSQVRFLLPGNRAPLADSDDFNMDNWEV
Download sequence
Identical sequences Q9W4V2
FBpp0070521 7227.FBpp0070521 FBpp0112237 FBpp0070521 NP_726832.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]