SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070616 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070616
Domain Number 1 Region: 219-526
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.42e-55
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070616   Gene: FBgn0029704   Transcript: FBtr0070648
Sequence length 653
Comment pep:known chromosome:BDGP5:X:4213473:4215778:1 gene:FBgn0029704 transcript:FBtr0070648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKATTSAAAKSQGNSKMQKNANNGTAKDKKKPNLDKESNDSNSVSDMLAVTKDQEVHAF
FSKLFDDDAGPSTSKKTQSGSAAAAKTADRKRRLQAEADANNNDTGKAGKLTKESEATQG
ARATKRKQARSLGLERTSPIQVNGAALACPLVRKSLPPGEANSCPQPPKKDPAAVNSLVK
IIKAEPTEEGNNNNDEKETETIETHKADSVEEGRRVLQWILFPVQTKVFFKDFWEHTACL
VQRSNPKYFQSMISFKMLDEILIRHHLDFTVNVDVTTYKNGKRETLNPEGRALPPAVWGF
YSDGCSIRLLNPSTYLIRLRQVCTVLQEFFHCKVGANLYLTPPNSQGFAPHYDDIEAFVI
QVEGRKRWLLYEPPKKADQLARISSGNYDQEQLGKPIIDEVLSAGDVLYFPRGAVHQAIT
EEQQHSLHITLSVYQQQAYANLLETLMPMVLKKAVDRSVALRRGLPLHTFQVLGNAYKGN
DCGSRKQLVENVQKLVTNYLMPSEDDIDEAVDQMAKKFQHEALPPIVLPSEEVRTVHGAR
SDADEQGNCVCDYKFNKKTSVRLLRANILRLVTESDGSVRIYHHVDNGLDYCKYEPYFME
ILPEEAKAVELLISAYPFYLTIDQLPLESSARKIEVATALWEHGLLMTEKPFK
Download sequence
Identical sequences E2QD64 Q7K4H4
FBpp0070616 FBpp0070616 FBpp0070616 7227.FBpp0070617 NP_572160.1.81976 NP_726923.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]