SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070667 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070667
Domain Number 1 Region: 192-305
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000261
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070667   Gene: FBgn0029713   Transcript: FBtr0070699
Sequence length 465
Comment pep:known chromosome:BDGP5:X:4443916:4445911:-1 gene:FBgn0029713 transcript:FBtr0070699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLCPLAFAVLLGLFHLIQACNHWVLREEQIVPKLDSPFHMREPHNLAAFLKQIRYSEYV
ERSYLDLLRKREQIVEHLRFSMRFGEDLAEQAKCAMDYYMLEKRMSYLKITPEQLKRINL
PDQRQLHIQKSASSMGMEPICSDYHRLSVGPATYDHLESFRPEVLAAAFLEREHDTNVGM
ATVELTRRFAVDGLQHHPASWKFHTLSSYYWRMRGNAREALPCARLAALLAPPIFKDIPL
LSLGTILFRMGRLADADLILTAAVEHAPNVAENHVVLASALAMKHDFNRSLQHFDEAERL
DPSTLPRTQQVRNFISCLENLTKKTSKMYSYVKYMQNEVKEFKKLKHHISQNHERLIQQQ
LPLGARRLLGLDAKTNNDDLHRRGQYCSTRTPNGSDEPVLFCDFYSDMQMRLESKDVDID
VLERDLKANTDAVIRQVSTEIRKQFNLEQLKAAKAQMPAKATKAT
Download sequence
Identical sequences Q9W4J6
FBpp0070667 FBpp0070667 NP_572169.1.81976 FBpp0070667 7227.FBpp0070667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]