SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070684 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0070684
Domain Number - Region: 16-51
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0785
Family SIAH, seven in absentia homolog 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070684   Gene: FBgn0029729   Transcript: FBtr0070716
Sequence length 237
Comment pep:known chromosome:BDGP5:X:4720007:4720866:1 gene:FBgn0029729 transcript:FBtr0070716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRASSIDESIGHSKPAICPLADCQAVVEHTHLLRHMITKHLDPRARTLPFQLRLREVS
TGQRTLLMLPYRQLIIDNDQCLAVLNWSSVSQGDLTAPQLDLPPCHQMLTYHLPILVMVC
RTTWKSLLKQIDEKDMQETRDVTAEWGGVYLFWLLSPLTRRPIYANLALLNSQIQSVYRR
NRRRIRNFASRMPIRQFINGLDPYFVSINEDQLDELCNGGGNRFSIYFEVIIEGVMS
Download sequence
Identical sequences Q9W4G5
FBpp0070684 FBpp0070684 7227.FBpp0070684 FBpp0070684 NP_572190.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]