SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070751 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070751
Domain Number 1 Region: 300-491
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.06e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000085
Further Details:      
 
Domain Number 2 Region: 81-172
Classification Level Classification E-value
Superfamily SH2 domain 7e-21
Family SH2 domain 0.00035
Further Details:      
 
Domain Number 3 Region: 233-294
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.64e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070751   Gene: FBgn0029778   Transcript: FBtr0070785
Sequence length 494
Comment pep:known chromosome:BDGP5:X:5510605:5512834:-1 gene:FBgn0029778 transcript:FBtr0070785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRNTEAGAGNANTGGSGGVGGAPEPSSPVQKVWKPELYKLQLEAPAPCPLRCQRTLPLP
PAKSTAEAVEANNLAGRLYGSEYHGLMGHLEAEQLLANARDGSYFVRRSPQSDGYYTLSL
RFNKRPKHYKLLYKPGVGHYLRGQDKRFDTVHDMVADGLINFHMQLHASPIIQQINQQTK
NCYQQSPYMTLNGRKLRALSNELGKAAAKESKESPAEEKEQKQEEPPPPAVDPMPLVYEK
PHHFKVHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCVPDLKRIRG
VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREG
EKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAV
RRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEIFML
SSLITHCKTIFATS
Download sequence
Identical sequences Q9W4A9
FBpp0070751 NP_727007.1.81976 7227.FBpp0070751 FBpp0070751 FBpp0070751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]