SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070876 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070876
Domain Number 1 Region: 132-210
Classification Level Classification E-value
Superfamily WWE domain 3.4e-24
Family WWE domain 0.00000501
Further Details:      
 
Domain Number 2 Region: 44-130
Classification Level Classification E-value
Superfamily WWE domain 1.19e-23
Family WWE domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 535-624
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000996
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0070876
Domain Number - Region: 476-516
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0314
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070876   Gene: FBgn0000524   Transcript: FBtr0070914
Sequence length 738
Comment pep:known chromosome:BDGP5:X:6428043:6432615:1 gene:FBgn0000524 transcript:FBtr0070914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAGSAASGSVVPGGGGSAASSCATMALSTAGSGGPPVNHAHAVCVWEFESRGKWLPY
SPAVSQHLERAHAKKLTRVMLSDADPSLEQYYVNVRTMTQESEAETAGSGLLTIGVRRMF
YAPSSPAGKGTKWEWSGGSADSNNDWRPYNMHVQCIIEDAWARGEQTLDLCNTHIGLPYT
INFCNLTQLRQPSGPMRSIRRTQQAPYPLVKLTPQQANQLKSNSASVSSQYNTLPKLGDT
KSLHRVPMTRQQHPLPTSHQVQQQQHQHQHQQQQQQQHHHQHQQQQHQQQQQHQMQHHQI
HHQTAPRKPPKKHSEISTTNLRQILNNLNIFSSSTKHQSNMSTAASASSSSSSASLHHAN
HLSHAHFSHAKNMLTASMNSHHSRCSEGSLQSQRSSRMGSHRSRSRTRTSDTDTNSVKSH
RRRPSVDTVSTYLSHESKESLRSRNFAISVNDLLDCSLGSDEVFVPSLPPSSLGERAPVP
PPLPLHPRQQQQQQQQQQQLQMQQQQQAQQQQQQSIAGSIVGVDPASDMISRFVKVVEPP
LWPNAQPCPMCMEELVHSAQNPAISLSRCQHLMHLQCLNGMIIAQQNEMNKNLFIECPVC
GIVYGEKVGNQPIGSMSWSIISKNLPGHEGQNTIQIVYDIASGLQTEEHPHPGRAFFAVG
FPRICYLPDCPLGRKVLRFLKIAFDRRLLFSIGRSVTTGREDVVIWNSVDHKTQFNMFPD
PTYLQRTMQQLVHLGVTD
Download sequence
Identical sequences Q23985
FBpp0070876 FBpp0070876 7227.FBpp0070876 FBpp0070876 NP_511064.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]