SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070884 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0070884
Domain Number - Region: 211-276
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0115
Family Arfaptin, Rac-binding fragment 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070884   Gene: FBgn0003655   Transcript: FBtr0070922
Sequence length 548
Comment pep:known chromosome:BDGP5:X:6257451:6259742:-1 gene:FBgn0003655 transcript:FBtr0070922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQDESFPTDELFDQLNNLSSSGARNTWFAEHHKPAVFERDTAPFLEICYADPDFDADG
DVANKSAKTCVSDPVGRDQEDEDDYDEDVDGDDHKLGCEKAPLGSGRSSKAVSYQDIHSA
YTKRRFQHVTSKVGQYIAEIQAQDQKRRNVKFAGFQRVNSMPESLTPTLQQVYVHDGDFK
VDKNCQTHSNSDSNYNSNSNNSSSSFDRLLAENESLQQKINSLRVEAKRLQGFNEYVQER
LDRKTDDFVKMKCNFETLRTELSECQQKLRRQQDNSQHHFMYHIRSATSAKATQTDFLVD
TIPASGNVLVTPHPLGDLTYNSSKGSIELALLSVAPSARVAQNPVQVQRAIHPQSLDFSS
VSTEADGSGSGEHRVETSSRALVRRTPAPNNSETSQPSSNDSAIEVEAHEEERPSSRRQW
EQQGELISPRQWGQHEGMYYFDKRNNRVIEVMGFNISQGRNQSHDTIHNQSINDSQTRLL
VHSMSMSHLEAHDHFRSKRTTLGSRMLRFLGPCVRCRNGDPLNRSNVTYKDGLPAMPEEE
FVDQRNQR
Download sequence
Identical sequences P40688
FBpp0070884 FBpp0070884 FBpp0070884 7227.FBpp0070884 NP_511060.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]