SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070904 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070904
Domain Number 1 Region: 86-136
Classification Level Classification E-value
Superfamily RING/U-box 0.000000141
Family Variant RING domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070904   Gene: FBgn0029877   Transcript: FBtr0070943
Sequence length 260
Comment pep:known chromosome:BDGP5:X:6483323:6484679:1 gene:FBgn0029877 transcript:FBtr0070943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHQHVLSEAAALRLINGLESAGNATMPLGAQPPQSAAAEAICSSQIVASAHGTPTAST
AALEISSARQRMLRSHLQESLHSANESGNSCRICRWNRNDMEIIKCPCNCKGSVCLKRWI
MHRRDNRCEICNAVFNIAEERASLKQMIRTFCCGRCCGLIVKHLLFSASLMPLAHIILQQ
VLQCMDNMNQGSTDQLTVQEVFVASCALLTSSALFFHFFEFVTTRFMLIRNILSHWWMFG
STSDFELVEIEDDSIDFFDD
Download sequence
Identical sequences Q8T8W9
FBpp0070904 FBpp0070904 NP_727100.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]