SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070997 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070997
Domain Number 1 Region: 23-212
Classification Level Classification E-value
Superfamily L domain-like 4.85e-38
Family Internalin LRR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070997   Gene: FBgn0029925   Transcript: FBtr0071038
Sequence length 238
Comment pep:known chromosome:BDGP5:X:6866357:6867443:-1 gene:FBgn0029925 transcript:FBtr0071038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQIKQQLETAQKTGILKISLQRLQEFPLQLRAYPNVLKTLDLSENRFERVPDELGKL
TLLKHLNLSGNRLVELNEVVGELAKLEVLLLMDNMLTRLPKTLANCTHLKTVNLSNNQLK
EFPSMLCGLKQLDVLDLSRNKITDVPADVGGLFVTELNLNQNQISSLAEEVADCPKLKTL
RLEENCLQAAAFTPKILKDSKICNLAVDGNLFNSKQFTDLDGYDVYMERYTAVRKKMF
Download sequence
Identical sequences Q9W3T9
7227.FBpp0070997 FBpp0070997 FBpp0070997 FBpp0070997 NP_572372.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]