SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071001 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071001
Domain Number 1 Region: 257-299
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000848
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071001   Gene: FBgn0029911   Transcript: FBtr0071042
Sequence length 303
Comment pep:known chromosome:BDGP5:X:6733455:6737953:-1 gene:FBgn0029911 transcript:FBtr0071042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKASTPATSGQQSPRSRTFSSSSTGAADSALQQQQHQHSNPGQNRGGNGGGGGGNDTT
GQGFNLLRTLPGLQVYHNQNSTSIDRQRARSLSSVPDIQQQAQQQQQQGSITSSGSSPHS
HPHAAHGHPAVGVTVSVSGNANANSNSNFTAAGNNNGSAMQSYMQQRRTLGDSIRDMSMT
GGSIAESIALAASATSANGIGRVYTATSLPSHIWSFNGIKCPVCNKFVLPDDIECHLVMC
LTKPRLSYNEDVLSDAKGECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCPEH
PGD
Download sequence
Identical sequences Q9W3V3
FBpp0071001 7227.FBpp0071001 FBpp0071001 FBpp0290102 NP_001162682.2.81976 NP_572359.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]