SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071135 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071135
Domain Number 1 Region: 30-93
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000847
Family Variant RING domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071135   Gene: FBgn0030015   Transcript: FBtr0071187
Sequence length 323
Comment pep:known chromosome:BDGP5:X:8055568:8056825:-1 gene:FBgn0030015 transcript:FBtr0071187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQFMHLPLHSRLRRLRSGLEPPSGNVVDDRMCWICLRGDEDHRRRDWVHPCRCRGTNK
WVHEACLSRWIDEKEMLSPGAPVTCTQCRTEYIIVMPPLCRFDAMLERLDKGCDRMCPSV
LMGILAATVYFSAVIYGALTVLQLAGYSTGMKLLQEDPSLLMIVLPSVPTLLLLSRLVRW
EDCVIRWLRRRKRSAIPAEQLDAVGLPLPGAPLSDEYFDELEREYPASDGLIGGNLATEQ
LGRASTSFCIALSLPTISVVLGQKLFGRIYEENKLLSILLGGLTFVTIKGLASIFLSQSQ
YQQRRHRFVMDYTPRNRINYQSR
Download sequence
Identical sequences Q9W3I6
7227.FBpp0071135 FBpp0071135 NP_572456.1.81976 FBpp0071135 FBpp0071135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]