SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071138 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071138
Domain Number 1 Region: 209-482
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.38e-72
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071138   Gene: FBgn0030007   Transcript: FBtr0071190
Sequence length 498
Comment pep:known chromosome:BDGP5:X:8037937:8039635:-1 gene:FBgn0030007 transcript:FBtr0071190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPDLTERILQHLETTDKADTLDLAALFAEDHQKIVGSLKSIQAHGELVTAETVTHKSLG
LTDEGRAVVENGSHEALVYDLVPPEGIAQAALMAAGGANAKVGFSKAMSHGWILVDKSVT
PPLVRRKVDTITDVVRNQLQQVALGKGDQLPAKEVADFKKRKLLQETTTKSFVLARGPEF
ATTLTKLETDLTVEMLANGLWDQLKFKAYNFDALGAPPTRGHLHPLLKVRTEFRQIFLEM
GFSEMPTNNYVESSFWNFDALYQPQQHPARDAHDTFFVNHPAKSHKFPQDYLERVKKVHS
VGGYGSKGYGYDWKLEEAQKNLLRTHTTAVSARMLYKLANQEGGFKAAKYFSIDKVFRNE
TLDATHLAEFHQVEGVIADVGLTLGDLIGTLYEFFRKLGITQLEFKPAYNPYTEPSMEIF
CYHPGLAKWIEVGNSGVFRPEMLLPMGLPENVNVIAWGLSLERPTMIKYGINNIRDLVGP
KVDLKMVEEGPICRLDHA
Download sequence
Identical sequences Q9W3J5
7290891___KOG2784 FBpp0071138 FBpp0071138 FBpp0071138 7227.FBpp0071138 NP_572448.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]