SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071314 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071314
Domain Number 1 Region: 361-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000564
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 329-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000107
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Weak hits

Sequence:  FBpp0071314
Domain Number - Region: 22-84
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0377
Family FCH domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071314   Gene: FBgn0000233   Transcript: FBtr0071379
Sequence length 644
Comment pep:known chromosome:BDGP5:X:9588221:9591606:1 gene:FBgn0000233 transcript:FBtr0071379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDAACNYLNPYAQQHQAQQQQHAQHQQHAQQQQHHLHMQQAQHHLHLSHQQAQQQHMQH
LTQQQQQQQQQQQQQQQQQQQQQQPQQQQHDFLSAAALLSAPPSLSGSSSGSSSGSSPLY
GKPPMKLELPYPQASSTGTASPNSSIQSAPSSASVSPSIFPSPAQSFASISASPSTPTTT
LAPPTTAAAGALAGSPTSSSPSSSAASAAAAAAAAAAAAADLGAAAVASAAYGWNTAYSG
LGPARSQFPYAQYASDYYGNAVGMSSSAAWFSHQERLYQPWSSQSYPGFNFDDIAFQTQL
QRRSVRCTCPNCTNEMSGLPPIVGPDERGRKQHICHIPGCERLYGKASHLKTHLRWHTGE
RPFLCLTCGKRFSRSDELQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFKDKKSK
KVLAAEAKEQAAAAIKLEKKEKKSGKPLTPPVEFKQEQPDTTPLVNYAPYANLYQHSTSA
GSSVNPPPPPPPLFQQQMTTTTSSAAASFVEQPWSSSSSRAIQPATTSASSSSSSSASSP
AAAVVSAIGSASSPAASATALAQHHYAALAMQSESQLAAEYGLTMSGLASGASQDSSSSC
HMKSEYAASYPADFGAGTASYGYPHPHPHHHNAWAAAYHPHATA
Download sequence
Identical sequences Q24266
NP_511100.1.81976 FBpp0071314 FBpp0071314 FBpp0071314 7227.FBpp0071314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]