SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071392 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071392
Domain Number 1 Region: 48-277
Classification Level Classification E-value
Superfamily L domain-like 1.31e-34
Family Internalin LRR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071392   Gene: FBgn0052687   Transcript: FBtr0071458
Sequence length 377
Comment pep:known chromosome:BDGP5:X:10376061:10380660:-1 gene:FBgn0052687 transcript:FBtr0071458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVYTSDSSDTDSREQKTLDFGRMSLDLVTLEDHLASPQKALLKSSGDIETMLLNHNRLV
GLPRLLLQFGNLKILDLSSNAITTLPDAVCQLPLVTLIAKNNLLTNASLPKSLLTKMANG
NGNGNATGGTNSTLKELNLSGNQLTHFPEQVTELRHLKYLYLGGNKISSVSKDIWKMQSL
HVLSLGGNLISEVPEAVGSLNQLQALVLCDNLIEILPTSIARLKNLKSLLLHKNRLRHLP
KDIVALKNLTELSLRDNPLVVRFVQDMALKPPTLLELAGRMVKASGQRPGPYDIPRTLAE
YLNSANCCVNPNCKGVFFDNRVEHIKFVDFCGKYRVPLLQYLCSSKCIEPEQPAARGSSV
PAASASSGFMMRKVLLG
Download sequence
Identical sequences Q9W2U2
7227.FBpp0071392 NP_001259412.1.81976 NP_727428.1.81976 FBpp0071392 FBpp0071392 FBpp0071392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]