SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071509 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071509
Domain Number 1 Region: 37-250
Classification Level Classification E-value
Superfamily L domain-like 4.68e-34
Family Ngr ectodomain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071509   Gene: FBgn0034602   Transcript: FBtr0071583
Sequence length 343
Comment pep:known chromosome:BDGP5:2R:17081076:17086936:1 gene:FBgn0034602 transcript:FBtr0071583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELHWQLLTFIVCLQLLHSAGFIIQSEVRKCTYGHIDKLLRIRCYDLDLKEVPQNLKSSV
EVLDLSHNRIRKLKTSSFQRYTDIKFLMLYDNMILSVEVGTFEPLTSLQEIDLSNNGLTT
IPLELFQLPRLRNLYIDSNELTSLNLQALEKPIRAPLEYLNVAGCELQELPDLGILPKLW
QLNASMNPLQNFRIDSLANMCHLQVIDLTKSQLSQCGCQQVTNHLMMLGASPKFVPVCLE
ALDIRECPLPYNRTIHSPTFASCQTTLQFAETRSFWLFGAGCFGGVCFVLLIVIFCVIHC
RRKRAQRRKRNAQKRKPFVISPRNAINNRQPEDEPLHCDIARK
Download sequence
Identical sequences Q9W2J7
FBpp0071509 FBpp0071509 NP_611561.1.81976 7227.FBpp0071509 FBpp0071509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]