SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071570 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071570
Domain Number 1 Region: 888-1159
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-73
Family Protein kinases, catalytic subunit 0.0000000207
Further Details:      
 
Domain Number 2 Region: 345-537
Classification Level Classification E-value
Superfamily L domain-like 1.08e-46
Family L domain 0.0001
Further Details:      
 
Domain Number 3 Region: 69-231
Classification Level Classification E-value
Superfamily L domain-like 3.12e-44
Family L domain 0.00023
Further Details:      
 
Domain Number 4 Region: 207-355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.3e-19
Family Growth factor receptor domain 0.00000272
Further Details:      
 
Domain Number 5 Region: 523-634
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7e-19
Family Growth factor receptor domain 0.0000369
Further Details:      
 
Domain Number 6 Region: 636-751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000348
Family Growth factor receptor domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071570   Gene: FBgn0003731   Transcript: FBtr0071653
Sequence length 1377
Comment pep:known chromosome:BDGP5:2R:17410510:17446932:1 gene:FBgn0003731 transcript:FBtr0071653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMIISMWMSISRGLWDSSSIWSVLLILACMASITTSSSVSNAGYVDNGNMKVCIGTKSRL
SVPSNKEHHYRNLRDRYTNCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILISHVDVK
KVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCH
MRTIQWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHGCWGEGPKNCQKFSKLTCSPQC
AGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLE
TNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGECVPCNGPCPKTCPGVTVL
HAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITG
YLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVV
IQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQ
CLTCKNFNFNGTCIADCGYISNAYKFDNRTCKICHPECRTCNGAGADHCQECVHVRDGQH
CVSECPKNKYNDRGVCRECHATCDGCTGPKDTIGIGACTTCNLAIINNDATVKRCLLKDD
KCPDGYFWEYVHPQEQGSLKPLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQC
ETECPADHYTDEEQRECFQCHPECNGCTGPGADDCKSCRNFKLFDANETGPYVNSTMFNC
TSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVT
YICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIGANLCKLRIVKDAELRKGGVLGMGAF
GRVYKGVWVPEGENVKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMS
SQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNV
LVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVT
IWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQ
LTTVFAEFARDPGRYLAIPGDKFTRLPAYTSQDEKDLIRKLAPTTDGSEAIAEPDDYLQP
KAAPGPSHRTDCTDEIPKLNRYCKDPSNKNSSTGDDETDSSAREVGVGNLRLDLPVDEDD
YLMPTCQPGPNNNNNINNPNQNNMAAVGVAAGYMDLIGVPVSVDNPEYLLNAQTLGVGES
PIPTQTIGIPVMGVPGTMEVKVPMPGSEPTSSDHEYYNDTQRELQPLHRNRNTETRV
Download sequence
Identical sequences Q8MLW0
FBpp0071570 NP_476758.1.81976 FBpp0071570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]