SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071588 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071588
Domain Number 1 Region: 21-246
Classification Level Classification E-value
Superfamily L domain-like 2.38e-43
Family Internalin LRR domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071588   Gene: FBgn0034655   Transcript: FBtr0071671
Sequence length 341
Comment pep:known chromosome:BDGP5:2R:17576417:17577758:1 gene:FBgn0034655 transcript:FBtr0071671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVCQFFRNNYVLANCEDAIYKKAFSLNLSHYQISDVPGIIEKCETLMKLFLNQNKLTK
IPSSIGSLMRLQVLTLDYNKLDEFPLCICRLVRLKFLNISCNNISSLPPELGYLTQLETF
WCNNTGLLELPNEIRNCEHLETLGVRGNPLKKLPDAIGALSSLRWLTAEGCELSEVPLTM
ALLGNLVHLNLKGNRLRRLPRMLMAMQKLRFAFLNENCIDEMPTRSQLEELRTLHMLNLS
KNPISLHRDLQLMALRQTNLYVELPSDPANICDGLASRASLNAQEQQEDQARGAGQDLDS
SDWANSVRTSELDTTDESALENNIEDLSVMLPEMSRFVTTF
Download sequence
Identical sequences Q9W2D7
FBpp0071588 FBpp0071588 FBpp0071588 7227.FBpp0071588 NP_001286690.1.81976 NP_611605.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]