SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071688 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071688
Domain Number 1 Region: 303-359
Classification Level Classification E-value
Superfamily RING/U-box 7.06e-18
Family RING finger domain, C3HC4 0.00025
Further Details:      
 
Domain Number 2 Region: 151-235
Classification Level Classification E-value
Superfamily RING/U-box 4.95e-16
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 222-291
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000157
Family IBR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071688   Gene: FBgn0025186   Transcript: FBtr0071774
Sequence length 509
Comment pep:known chromosome:BDGP5:2R:18100346:18104769:1 gene:FBgn0025186 transcript:FBtr0071774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDIEMDMESDNDGEYDDDYDYYNTGEDCDVERLDPKRADPEYFEYECLTVEDIEKLLN
ERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVAVTDTAS
TSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWT
IYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELR
FCPGPNCQIIVQSSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSET
ANYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEYYECSRYKDN
PNIANESVHVQAREALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWID
WQYLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAET
TDLGDLENQMDIAEKRRTTLLKDFFPVDA
Download sequence
Identical sequences B4QH37 O76924
NP_477374.1.81976 XP_002082598.1.80810 FBpp0071688 FBpp0210056 7227.FBpp0071688 FBpp0071688 FBpp0071688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]