SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071712 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071712
Domain Number 1 Region: 165-275
Classification Level Classification E-value
Superfamily TPR-like 1.49e-20
Family Tetratricopeptide repeat (TPR) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071712   Gene: FBgn0034692   Transcript: FBtr0071799
Sequence length 410
Comment pep:known chromosome:BDGP5:2R:17973174:17975136:-1 gene:FBgn0034692 transcript:FBtr0071799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNVLNTILAVDKEQELLQSFIRTGAAAEEESQDETNRRSKGRSHKPPIWERRESTDRGG
RGAGRDGKQGDDGGAGGGAGGDAAGGKRGNRIEAELRAARKKIEEQIAKKKKPKENFVDF
YTDKDRAAAVSAGAFDIKQSLQIKQKQDRNEALLIPDEADISSVIALGLKEIKNANPENA
IHFFCKALELNSTDINALISRSKCYLLLGEASKALQDAETALGEDKNNIRAIYQKAESLY
YLGQFEQSLMFFHRGLRARPELALFRLGVQKTQEAIENTIGSKPGPPGPTASVPKSGKSR
KSGEDTPKSQAAGATGTSARTRQKPSRADLERRNARKLLGELCVDKEYLEKLLLHPDLVR
ADTHTESISAYAREAVEFLNKRQEFWRQQRPCTALPNHKNLPHDALPKWF
Download sequence
Identical sequences B4QH17 Q9W295
FBpp0223549 FBpp0071712 FBpp0071712 NP_611637.1.81976 XP_002082578.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]