SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071725 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071725
Domain Number 1 Region: 202-478
Classification Level Classification E-value
Superfamily L domain-like 8.16e-42
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 15-269
Classification Level Classification E-value
Superfamily L domain-like 1.85e-31
Family Internalin LRR domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071725   Gene: FBgn0034717   Transcript: FBtr0071812
Sequence length 915
Comment pep:known chromosome:BDGP5:2R:18180966:18184460:1 gene:FBgn0034717 transcript:FBtr0071812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIVLELALLVLGVISSCRAVNCPWPCRCTWVVDSLYADCSRRSLQTYPNFDGIPVEHLD
LSGNKFLEFPTLYADIDSLIYLDLSSNYISSIGAKTLIGFTSLRTLLLANNSIDSWESLS
PNEAFKYAPSLKRLGLDGNRLGSFGNGESFELLTSSSLTDLGLSSCGISSIGGDQMVNQL
PNLERLNLANNQLAQIAALPSRTLRVLDLSNCSIKNLSGFFLDAMQNLEALNLSRNTELQ
FDSLSEDPILTYMLRKLDVSYCNLDSIELSGLPQLTEVRLQGNLLRVVDVNTFANNSMLE
VVDLSQNVLRHIGQDAFAKLKRLKELNLAFNEIARLDRNFIRNNDVLVELNLSRNVLQKL
TKIVSNSVRTINMSWCEITSIESTALSSLSVIQKLDLSNNLITDMPTFMRSETLQQLNLA
NCRLTTVRNNTFREFPELADLHLNGNRLTSPIPPNYFDGNKFLDQLWLGDNPWICDCHSP
LFVDFYDYLTAKPAKIKDRNHLRCAAPAVFYGKLWEFACADVWILNARTSSTGEKAWSII
MLTLLGLGALVLGYACLQKYLRKRKVRQSDREYEENDDELRRIRDLNERILREEATPSLQ
HTQEISLLPSYEDALRMPKLVRPVKSMMDLSGPERARNSRKLRRSQTHADGDGSQSEAED
GLQLDSRQRFRSVEMLSNRDKERTAQYGPYRRTGYMEYNQSGSRRFSIEDSRFPAAHLKT
QNLQSAEQIGNFQSYENSPYTKRKPKIAEIPPFKRVNMMADSVEFLTDPEYDEVGSKHGS
PFAKRKPKPPVLPPPTMKVSAQVYTLQQSPVLELDPAIEDYFSAARKQPSSSTIASDFQE
LDEPELKSLPDDNRSSTISRSDVEQDLERGKRKKRKNSTSRRVSGSFTAANAAESSSSDS
ELNALVHKPMRETLF
Download sequence
Identical sequences Q7JWP9
7227.FBpp0071725 FBpp0071724 FBpp0071724 FBpp0071725 NP_001246458.1.81976 NP_611660.1.81976 NP_726186.1.81976 FBpp0071724 FBpp0071725 FBpp0300937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]