SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071727 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071727
Domain Number 1 Region: 456-730
Classification Level Classification E-value
Superfamily L domain-like 1.25e-40
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 2 Region: 290-545
Classification Level Classification E-value
Superfamily RNI-like 1.73e-35
Family Cyclin A/CDK2-associated p19, Skp2 0.03
Further Details:      
 
Weak hits

Sequence:  FBpp0071727
Domain Number - Region: 775-889
Classification Level Classification E-value
Superfamily ARM repeat 0.00489
Family MIF4G domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071727   Gene: FBgn0013272   Transcript: FBtr0071814
Sequence length 1051
Comment pep:known chromosome:BDGP5:2R:18205170:18216933:1 gene:FBgn0013272 transcript:FBtr0071814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQSTCRLVLLLAFTLALIHASHSNTVGPKIHFIHDDLTENELNSGEEVSPTESLPKIS
TPKVKDLPVETTTRSPTKKTTSSGTEKSLSEEAWNDLMEAAKHSQALADDPHFNKMLNTT
VAAGEKNSTDTDDSEYYDYDDDYNYFDEETVTISPSPKKAKSNPKLQPIVDATITKSKSK
SNDQKTKESANDIDSDSQYDYDEGLDDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA
RNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIA
NCTLEYLHAEAFHGLNELYAVNLTDVGLAIINPDTFVGNKKLRMLTISGNDLSVMSSIHY
LLKSSSIEELDFSRNNLMELNPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDL
SYNSLTELPRDIFNGTTLSILHLKYNTFNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKM
PGLTNLNLKGNGIKKIQPDSFLTLKNLRHIDLSINDLDQISGMLFFKNSELDVIRLNDNP
RLSQLPTDGFLSYSGEFTVYYLDISNCAIGPLGHKAFSTMPHLTTLKLAWNNINHLPREI
FTGLHKLIDLDLSNNLITRMDDLIFMDNGELTKLSLAGNPISRLSVRLFLPLHQLRCLDV
NDCELTTLLSDRDLGAGYKIFDSLRSFNASGNLIKKISSEDVKSFKNLRSLDITNNPLKC
TPDFQEFISYVTLQMQMTPKRLPVLANLEDDATIVQLETLAQAGWSSLAHEVCKHAEGSD
LLDEKKADSAEAKLEKRLKESVKKLNEDEAKLLSVLDKSVLDKSRLSSMQKIMKGSVNTE
TAKPEEDADEENLNNGGEDKEDDSSDYDSEEDDDDDDEDDDDDNNDDDRFEEAKKNAKAK
ADANKAFDTFVNKELKPVLKTDGIQAEEVDMSQETRDKFLLEKLGFDSESEESDEYTEKM
IFHGELSYDLVVPLIVVSFCLLMIVLSIARVIYVVLRKRGERYRMALLASKNSFVYQKLS
EDIVKPTSKEQKEPKHLKQPKVHRYAPINQV
Download sequence
Identical sequences Q24007
NP_001286714.1.81976 NP_726190.1.81976 NP_726191.1.81976 NP_726192.1.81976 FBpp0071726 FBpp0071727 FBpp0071728 FBpp0071726 FBpp0071727 FBpp0071728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]