SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071748 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071748
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000022
Family First domain of FERM 0.0095
Further Details:      
 
Domain Number 2 Region: 92-157
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000128
Family Second domain of FERM 0.0055
Further Details:      
 
Domain Number 3 Region: 323-429
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000132
Family Third domain of FERM 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0071748
Domain Number - Region: 543-590
Classification Level Classification E-value
Superfamily RING/U-box 0.000165
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071748   Gene: FBgn0260866   Transcript: FBtr0071837
Sequence length 676
Comment pep:known chromosome:BDGP5:2R:18451016:18480473:-1 gene:FBgn0260866 transcript:FBtr0071837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCIVNLPNGTQQAVKWDPKANGQECLEKVCRAMNIICEMEYFGLEHWTPNQKESQTRQW
INLRNRLSGDSGSSGSGIQLMLALRVKFWVPVHFILQESVRNLFYMQARRDLLEGRLTAP
DWSGAAKLAALLCQADGLRFNESSLKADCPMRMRRELAQQQQQQQQQAQQHRLEQQRKEK
EHVLSFKKRRLSKQKSMEHIEVCTLPAASTTSCSLQPSPSASASASASASASASASTSAC
SQTHSNSSSSSPSNSSSQTGLDERLASNPLRVYEEYFMQPSCEGEPPADYLRQIAVEHGK
LAKLQMSLKTAKYWLLKSIQDLEGYGEELFSGVTTNESATRCDIAVGAHGITVCRGGEKQ
SIPFGAIAAAKSLRRTFKLEYVDDHNDRKELEIKLPKQPIAAGLYRSITERHAFYVCDKV
RGVVTNQFTRDLKGTIASMFMENTELGKRYVFDIQHTCREVHDQARRTLHERGGDLVAEG
AEGCSAVAGGLGASAVGEPGVSPWAMALTTGAGGSMAGKIDLAIREKEAREAAIERCVDT
RISEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYLPPELRT
SQTGSGATTTSSSSIMGDGQVEEQLLQQQLDEISAAPASLEAGADAGVGVGGMAVGAGAG
AGATGPGGQPKVTTAA
Download sequence
Identical sequences Q8SWW8
7227.FBpp0071748 FBpp0071748 FBpp0071748 NP_611680.2.81976 FBpp0071748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]