SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071757 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071757
Domain Number 1 Region: 669-735
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000539
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 
Domain Number 2 Region: 586-655
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000288
Family SAM (sterile alpha motif) domain 0.038
Further Details:      
 
Weak hits

Sequence:  FBpp0071757
Domain Number - Region: 749-788
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000414
Family SAM (sterile alpha motif) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071757   Gene: FBgn0034720   Transcript: FBtr0071846
Sequence length 1023
Comment pep:known chromosome:BDGP5:2R:18221009:18260610:-1 gene:FBgn0034720 transcript:FBtr0071846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADNQPLQQQLQHHQHRSPAYPGKPAEAAGGVPQQQQQQQQLPNGIGSSHCNSNSNGIS
STCNSGTAMIHANNSNLIAAGHLAQAAGPAHNAPSSGSALNAVDKRNANLSEPDQDLPPN
LNVNLSPNPSLALGAPHSPTSAASAALLLLESCDGNRNDESRFHHLHSAPRPEATMKLRE
ENDRLNAELLRLRRLLELSTDGAVGGVDTAPEMEAVASGEGSAAKERIERLESELRSVKN
QLLTMRLERKKLRTDKSDLLGQVKQLCASLQEKEQELRDFIRNYQERVRETETTNAKISG
DRDRERFQLLKQARDEAERSLALAQQLSARDLQLQRLQEQLQEARRQLTGCLSDQESLHS
FAPLTPPSAASGMLSQMAAASGMGGGLAGMRGTTEDSGRGNSLSAFSGSLSGGSGATAGD
RNSCSNDSGLRNSSDRESTGGELNFSDGTCDNGPCITVDPDSISLVSSQNMYQFGTPKER
SPTLSPLNSAAYSRSVEQLGSPVDPEGPGNGAISRKFANASKSGPLGARNGRGGTWGSIS
RVFARSRNKNKALSADGVTEYADYSWNPLTEEGYAEKLRLLREASQLPIDRWRATQVLAW
LEVALGMPQYSARCAENVKSGKVLLELNDVELEAGLGLAHPMHRKKLRLAIEEQRRPEMV
RYPLITQLGHTWVATEWLPDIGLPQYAEPFVQSLVDARMLDTLSKKELEKFLGVTRKFHQ
ASIVHGIHVLRIVKYDRQTLAMRRVQSETVDTDPIVWTNQRFIRWVRSIDLGEYADNLKD
SGVHGGLVVLEPSFSGDTMATALGIPPSKNIIRRHLNTEFDALILPARATLGQGIRSGCG
VVPLTGPGGLQHYATTDRRSSGNLRISAWKGSQSSLSKAFRFNSKPHRTGDRSSFGNSTS
PTPSYSSSEGGGGIYATIGHQYPNPHTNLQQQHYHHFLPPPTTAPPPIPSAGGIYSHGPP
PGHRVSAPPVGGALDAVSTDPQMLYEQSRRRVKSISDIGASTSAGSVGACSLGGISASSE
SPE
Download sequence
Identical sequences Q9W263
FBpp0071757 FBpp0071758 FBpp0071757 FBpp0071758 NP_611663.2.81976 NP_995922.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]