SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071761 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071761
Domain Number 1 Region: 46-216
Classification Level Classification E-value
Superfamily L domain-like 8.5e-21
Family Ngr ectodomain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071761   Gene: FBgn0034718   Transcript: FBtr0071850
Sequence length 677
Comment pep:known chromosome:BDGP5:2R:18185718:18199421:-1 gene:FBgn0034718 transcript:FBtr0071850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERVHLTAWLALFLIVVANATPTPARTPTGCPADCTCSLSQHTHKPLYHLKCNSTRGLRL
TEKTFQSTVPVHSIDLSHLNLTRLSHLLDKLPELTSADLSHNQLKDLGHLGKGLKRLNLK
HNQLTSDKLRKLPQHLQVLNLQHNNITHLPLELTHMHQLHQLELSHNAINCSCQTLEVRN
WLVERIVYMEHPVVCSYPLEFRGRSWLQLKQDEICKKEKYQWFDTEENELMMGDQPAAVS
AEREDEEELGKDFLPIVGNPAATAKKVRSPQIPLPSDQVEGSGDLSETNMELKLPEETVA
EPEAAESQLVDAAASPSVLEEHIVKDEDEDDEGSGSGGGLLIIPDPSKVKITSEDDIDSD
GKPEESDVRPLENPENSENPDTVFSNKIGIYEGDQEEKKPVEEDNIVPVVMTNLDTGLES
DVVTDGPLDSSKESEDILTAKIGKPKDDSSAIYYLLAVIGLIVVGLVLFVAIKRCKYDSN
AAARDAEAQRQTELLDMDKKQLGKPLHKNGHGNGQEHSPLIGEKTKLDEAQIVKKPYENG
EAKDGAGQQPLLNGNGSANGGTKEAPETGEPAAHEYYPITPRYPTPQSPRASKYAQQQQL
AEQNNNEPDGAYLPSSPKSGRYSPVYSPETGRVKIKLTETPKPKTPMLVTRSKSNAGDII
TTPVRPIEPTHQVINGH
Download sequence
Identical sequences Q9W266
7227.FBpp0071762 FBpp0071760 FBpp0071761 FBpp0071762 FBpp0071763 NP_001286712.1.81976 NP_611661.1.81976 NP_726187.1.81976 NP_726188.1.81976 NP_726189.1.81976 FBpp0071760 FBpp0071761 FBpp0071762 FBpp0071763 FBpp0071760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]