SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071833 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071833
Domain Number 1 Region: 675-861
Classification Level Classification E-value
Superfamily Fibronectin type III 2.54e-26
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 2 Region: 444-536
Classification Level Classification E-value
Superfamily Immunoglobulin 9.39e-25
Family I set domains 0.0087
Further Details:      
 
Domain Number 3 Region: 254-350
Classification Level Classification E-value
Superfamily Immunoglobulin 5.23e-24
Family I set domains 0.0029
Further Details:      
 
Domain Number 4 Region: 546-647
Classification Level Classification E-value
Superfamily Fibronectin type III 5.07e-21
Family Fibronectin type III 0.00036
Further Details:      
 
Domain Number 5 Region: 157-261
Classification Level Classification E-value
Superfamily Immunoglobulin 6.49e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 55-151
Classification Level Classification E-value
Superfamily Immunoglobulin 2.91e-19
Family I set domains 0.051
Further Details:      
 
Domain Number 7 Region: 335-436
Classification Level Classification E-value
Superfamily Immunoglobulin 4.91e-19
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071833   Gene: FBgn0005631   Transcript: FBtr0071922
Sequence length 1395
Comment pep:known chromosome:BDGP5:2R:18580029:18588467:-1 gene:FBgn0005631 transcript:FBtr0071922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPMHPENHAIARSTSTTNNPSRSRSSRMWLLPAWLLLVLVASNGLPAVRGQYQSPRIIE
HPTDLVVKKNEPATLNCKVEGKPEPTIEWFKDGEPVSTNEKKSHRVQFKDGALFFYRTMQ
GKKEQDGGEYWCVAKNRVGQAVSRHASLQIAVLRDDFRVEPKDTRVAKGETALLECGPPK
GIPEPTLIWIKDGVPLDDLKAMSFGASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVG
TRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVSRA
RILHDEKSLEISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNFTKRPSNKKVGLNG
VVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQEDEGYYVCS
AFSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFH
DGHAVQAGNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGSTSLH
RAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQTGWIV
AAQRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNTIKTIEADFDAASANDLSA
ARTLLTGKSVELIDASAINASAVRLEWMLHVSADEKYVEGLRIHYKDASVPSAQYHSITV
MDASAESFVVGNLKKYTKYEFFLTPFFETIEGQPSNSKTALTYEDVPSAPPDNIQIGMYN
QTAGWVRWTPPPSQHHNGNLYGYKIEVSAGNTMKVLANMTLNATTTSVLLNNLTTGAVYS
VRLNSFTKAGDGPYSKPISLFMDPTHHVHPPRAHPSGTHDGRHEGQDLTYHNNGNIPPGD
INPTTHKKTTDYLSGPWLMVLVCIVLLVLVISAAISMVYFKRKHQMTKELGHLSVVSDNE
ITALNINSKESLWIDHHRGWRTADTDKDSGLSESKLLSHVNSSQSNYNNSDGGTDYAEVD
TRNLTTFYNCRKSPDNPTPYATTMIIGTSSSETCTKTTSISADKDSGTHSPYSDAFAGQV
PAVPVVKSNYLQYPVEPINWSEFLPPPPEHPPPSSTYGYAQGSPESSRKSSKSAGSGIST
NQSILNASIHSSSSGGFSAWGVSPQYAVACPPENVYSNPLSAVAGGTQNRYQITPTNQHP
PQLPAYFATTGPGGAVPPNHLPFATQRHAASEYQAGLNAARCAQSRACNSCDALATPSPM
QPPPPVPVPEGWYQPVHPNSHPMHPTSSNHQIYQCSSECSDHSRSSQSHKRQLQLEEHGS
SAKQRGGHHRRRAPVVQPCMESENENMLAEYEQRQYTSDCCNSSREGDTCSCSEGSCLYA
EAGEPAPRQMTAKNT
Download sequence
Identical sequences Q9W213
NP_476899.1.81976 NP_726224.3.81976 FBpp0071833 FBpp0071833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]