SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071844 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071844
Domain Number 1 Region: 26-191
Classification Level Classification E-value
Superfamily Cyclophilin-like 5.55e-71
Family Cyclophilin (peptidylprolyl isomerase) 0.000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071844   Gene: FBgn0034753   Transcript: FBtr0071933
Sequence length 205
Comment pep:known chromosome:BDGP5:2R:18532448:18533851:-1 gene:FBgn0034753 transcript:FBtr0071933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFLSVFVVALVAGVVVADDSKGPKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVEN
FKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGA
GWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVK
DVVIANSGTLPVSEAFSVAKADATD
Download sequence
Identical sequences Q9W227
7227.FBpp0071844 FBpp0071844 FBpp0071844 7291447___KOG0880 FBpp0071844 NP_611695.1.81976 NP_726217.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]