SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071849 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071849
Domain Number 1 Region: 133-325
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.04e-36
Family AlkB-like 0.0018
Further Details:      
 
Domain Number 2 Region: 357-503
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.29e-24
Family UbiE/COQ5-like 0.017
Further Details:      
 
Domain Number 3 Region: 29-112
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000159
Family Canonical RBD 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071849   Gene: FBgn0034748   Transcript: FBtr0071938
Sequence length 615
Comment pep:known chromosome:BDGP5:2R:18521524:18523435:-1 gene:FBgn0034748 transcript:FBtr0071938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVEETQQKVNKAKKADKKQRRCLAIIKSDCEVSPSAEPTPYLAVLNVGLSNGLTEECLL
TEAAATGGKVIQVVMLPGKSYCFFICASLEDSQLIYEGMHNISTIGQQGAVAYLSYIRQL
PALAGKSEWNKPLPRGLHIIADFVTEEEESTLLRAIGEDGRTSEVTGSLKHRNVKHFGFE
FLYGTNNVDPSKPLEQSIPSACDILWPRLNSFASTWDWSSPDQLTVNEYEPGHGIPPHVD
THSAFLDPILSLSLQSDVVMDFRRGDDQVQVRLPRRSLLIMSGEARYDWTHGIRPKHIDV
VPSASGGLTTQARGKRTSLTFRRLRKGPCDCSYPALCDTQQTKVPQELHASLAAQAITLE
QQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDIGCGNGKYLSCNPLLLSVG
CDRAQGLLAVGRRKGQNVFRCDCLVVPVRSSSIDGCISIAVIHHLATKERRLAALQEMAR
VLRPGGRALVYVWAKDQRKNDKKSTYLRQNKAVNKERTTEQQQRQKQHQELEQQLSNNNP
LPVHTNRTEFQQQDVLVPWKTKDEQKTTYLRYYHVFEEQELENLVSQVHEVQLIKSYYDQ
GNHCAIFEKLSNNSL
Download sequence
Identical sequences Q9W232
FBpp0071849 FBpp0071849 7227.FBpp0071849 FR308 NP_611690.2.81976 FBpp0071849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]