SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071966 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0071966
Domain Number - Region: 30-56
Classification Level Classification E-value
Superfamily RING/U-box 0.03
Family RING finger domain, C3HC4 0.086
Further Details:      
 
Domain Number - Region: 38-103
Classification Level Classification E-value
Superfamily RING/U-box 0.0848
Family RING finger domain, C3HC4 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071966   Gene: FBgn0034870   Transcript: FBtr0072057
Sequence length 114
Comment pep:known chromosome:BDGP5:2R:19390469:19391338:1 gene:FBgn0034870 transcript:FBtr0072057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFARVPSTPPPSYEEAMGWETRRSHSTTWLLAENTSSLMICPMCHDEIETTTKIRRRW
IAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVCKATLGIVPQQDQRWPT
Download sequence
Identical sequences Q9W1P0
FBpp0071966 FBpp0071966 FBpp0071966 7227.FBpp0071966 FR180 NP_611801.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]