SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072164 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072164
Domain Number 1 Region: 92-214
Classification Level Classification E-value
Superfamily TPR-like 4.02e-31
Family Tetratricopeptide repeat (TPR) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072164   Gene: FBgn0015544   Transcript: FBtr0072256
Sequence length 534
Comment pep:known chromosome:BDGP5:2R:20046888:20049021:1 gene:FBgn0015544 transcript:FBtr0072256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQEKAFELQRQVRQNAREYENSVKDLYSWEQDIKNKEKELQKSPLSAANKDLPVRSHV
QTDKSRKESPSSSAASSPTEKQDLPVDPVAQQYKKANDIKDRGNTYVKQGEYEKAIVAYS
TAIAVYPHDPIYHINRALCYLKQESFDQCVEDCEAAIALDKLCVKAYYRRMQANESLGNN
MEALKDCTTVLAIEPKNIEAKRSLARINDRLRKIATKSGPNFTPDRPGMIEILPIEKPAY
KRSKKAMRSVPVVDVVSPRATIDDSNQLRISDEDIDKIFNSNCGIIEEVKKTNPKPTPMP
DTSGPPKAETIAKTSKEVKPTKQTAVKVAPAVETPKETETRKDTKIVPESDNEAKPSAPK
KTAVEVPKVQTQVSPPKTTIERSPEVNTVQTEKIEQASSNNAMSPSPIERFLPPAPTSTA
QFHVTWKELSGPQKYQYLKSIEVPNLCKILGAGFDSDTFADLLRTIHDFFVPNKEPNTAA
VLLEISKNDEFTILAMLMSAEEKKMVSSILNAIKNWPSKNPAVLDNLFKEYGVA
Download sequence
Identical sequences Q9V3E9
FBpp0072164 FBpp0072164 7227.FBpp0072164 FBpp0072164 NP_524664.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]