SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072202 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072202
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily L domain-like 2.04e-33
Family Internalin LRR domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072202   Gene: FBgn0035008   Transcript: FBtr0072295
Sequence length 240
Comment pep:known chromosome:BDGP5:2R:20361822:20362784:1 gene:FBgn0035008 transcript:FBtr0072295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYMVCDGLNSPRLQGGKEAEADGSQWPFPDKYHMRNTRILQVSKAQISEVPMEVFEAAQQ
ELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPTNISQYSKLTNLSLSNNLL
CDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIRAIDASESGLGGMR
ELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQILSMGTPALLSYLRTRIPI
Download sequence
Identical sequences Q0E8W8
NP_611915.1.81976 NP_726449.1.81976 7227.FBpp0072202 FBpp0072202 FBpp0072203 FBpp0072202 FBpp0072203 FBpp0072202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]