SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072214 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072214
Domain Number 1 Region: 36-94
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000742
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  FBpp0072214
Domain Number - Region: 235-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00777
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072214   Gene: FBgn0035024   Transcript: FBtr0072307
Sequence length 867
Comment pep:known chromosome:BDGP5:2R:20449132:20452581:1 gene:FBgn0035024 transcript:FBtr0072307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNGKPRSSARPSFHRRPKDGVANTTTDNAAVKPEALESYTGNDDNACVVCFKNVEIFSI
GDCDHPVCYECSTRMRVLCQQNECPICRHVLSKVLFTLDKLPYRELEANNRSDLYSKKYR
IGFCTAEIRQQFFKLLDHPCPKCDAPPYRTFEGLRNHVRSEHKLLYCDLCVETLNIFTFE
RRCYTQAELQLHNTKGDPDNRSHRGHPLCEYCNKRYVDRDELFRHLRREHYFCHFCDADG
CNEFYNDYADLAEHFRAEHFLCEEGKCATEQFVGAFRNEIEYKAHVANVHGKSLNKQQAK
QTRTLQVEITLGPRGRSGQTEQGITSVRTRNDEHNDYQNDLPSITQRHVSIDAGNEEQFP
TLRGASTAPSVSLVRPPPPSMRNLSGTSGLARTKENFPALGGGNGGGVTGPTSSSIAARA
AQSQHPVAAVFKKPTSAAGSGSRSGPPGNGMLLHVSNRSAAVPKKAATPQVDFPALPGKG
NKKNLRNLEEDMLPSGSPVPMANISAKHRSLADDYVSVASPSTFQKLQMVQKEEDEAKAR
QEALKKSAPKLTAAEFPSLGPSASASSSRTTAPKPSSGSPSLNWSKPANEKKQRELENRK
AKVAPAPVLPSPTSKPAPKASNNNVQEQQANKKDKKQKDKKSNQENQPKTAKPKERNNNN
EQKTNGAPSTPIRAPPGLKPGGPLKPPPGFVSNVTVNSVAKLPNNLTFTNSLGESYDIVP
SPYTYTDPPDTEVRNQKLVDEVMSLLKTPEALNEFRLLSSKFRDGSCSGQAYYEHCQCAM
LSSFYNLFPELLAMLPDISKQQELYLVHKQHLNSLPPAERKSVPALEVCKVCKQILITAD
LKSHQQAHELTKNFPVLGSSASNTHRN
Download sequence
Identical sequences Q9W149
FBpp0072214 NP_611932.2.81976 FBpp0072214 FBpp0072214 7227.FBpp0072214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]