SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072422 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072422
Domain Number 1 Region: 2534-2643
Classification Level Classification E-value
Superfamily Bromodomain 1.01e-35
Family Bromodomain 0.0000421
Further Details:      
 
Domain Number 2 Region: 2473-2527
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.87e-16
Family PHD domain 0.00065
Further Details:      
 
Domain Number 3 Region: 2417-2472
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000332
Family PHD domain 0.0016
Further Details:      
 
Domain Number 4 Region: 335-391
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000399
Family PHD domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072422   Gene: FBgn0000541   Transcript: FBtr0072522
Sequence length 2649
Comment pep:known chromosome:BDGP5:3L:233926:246912:-1 gene:FBgn0000541 transcript:FBtr0072522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGSRKRGRPPKTPNERASGRFNYQLLKKPKYLSEGKSQPSTPSASRGISPQSDEGSR
SSHNNHTNRSRGSAAKRGRGRKSAVQPNTSSYSGRKGYESEYHYGSDFGDSEEDKSDNED
DMLLTPSDDESLEVANESESEFSVCSFNQNGVGRPPRPPSPEPVWLQEGRQYAALDLPDS
SEDLFIANTHVLRALSIYEVLRRFRHMVRLSPFRFEDLCAALACEEQSALLTEVHIMLLK
AILREEDAQGTHFGPLDQKDTVNISLYLIDSITWPEVLRSYVESDKTFDRNVFHILSHTE
YPYTGIDNRLEVLQFLSDQFLTSNSIRDVMLQEGPIHYDDHCRVCHRLGDLLCCETCPAV
YHLECVDPPMNDVPTEDWQCGLCRSHKVSGVVDCVLPQEKQGVLIRHDSLGVDRHGRKYW
FIARRIFIEDQENFTCWYYSTTSKLKLLLSRLDAEELETRLHSQITERRDEIERQMKLTE
TLTNEHKHTKRSVIEIEQEAKNELLEKEVLDEDEKDGDAKSESQSIEGTKKQEECKMVTR
QKSNQLTNGTLHFKLGMEQGFKNYVNQYSTNPIALNKPQRNEERDKRRHLSHKFSLTTAS
DFKWIGITMGTTDNMITTLRQTLINFESNIAASFLNINWVVNKKIWNAAVMNARRPSEFA
VVLLLFQASLKSVVFANVWHEQLGHTTLQRITSAEREERKKLEKREKRERDDEEERNRLA
FNYIKYTLGLKHQVWKQKGEEYRVHGQWGWLWLSSSRRCGVRARRAQPLTHNRVYVHYTM
GEENDVNEIILVDPRTQRFMQQCESSNVDGQVCHYLPDQYKNVKVIEDVTEKIKGHIDVS
KALNAPGRTYYSKVARKSRLDDLLDRRLKLAEVEEQMASKIPSDMKPLLVSSQNNTANSK
QTFLEKRLLRLTEVQAKGGPANVNLELVNSLAKQIQTVRLQFSQLNRFAKVFRCYTKECN
TNSNAVSQITQNTCYSPLCLQKARAKKELLLLLRKAHTAGNGSKETVAAILGAVKKPSIL
EQKLTEGKRESTQVAVDDSEEGKPAESEAPLDLLQDWEHARAHAVPFSDSLLTECILVDQ
ECVTNTKIKQEVNASSGCNTTPDSNTQDSDKIDYIESMDVCSNVEIESTEDSIVTGLNSG
NAEDVDMTPGWRRKRNQKSKKSYIGTKDVLDQTLDKDIPLNKQNRRFPITARPVKRECVK
KYERETFENGNERVYSTSSPRGRVYLLNDAAKLYEQAVKTEDKSTITKKPSYSRYPLISN
FLTHKKKRSLLVLPRFELLKLARLGGKSSTNGFHHAAKNNTIWQYQCSRPLFRTCWSYRT
SNATSLSSLALQLRILWSCLRWDDMIAKPPSTDGKHQVTTDTEIVTLELLKLRHSGRYGE
KTSYLRRKVVIPLEMPKTVREVTSIRSGLRKRKRAESPQPTEPQITEEWVDEDKLELWEI
KFMGEKQEKARLSAVTRSVASRQLEASGSNGSNTSTNGALGVAGRVQLAPKLSEDVKEKM
EQQLKLQRAVHQQRKLVATGEITRSVTPVKGQVIGSRRVIVKNPDGTTRIIQQAVTQVSR
TGGANTAAAAASPTVGGSTSTQSNPSTSTPHKVQIIRGPDGKVSVRGLNPGQQLVQMPDG
KLHVLTTTTSSNSAGQGNKMKVPIKPASTSSSPAISSAQTTTNPVTPVIKQIAVKHVTKN
SATQSIASSSRVALPLAQIKNKLLLAQQQQQSTSSSPATSSSPVQKIVSKVVNTSTSGQT
LQQVFVQSGSKLVVGQNAQGQKVIISTSAAQQQGTSPVQQQQLVQSQPIQQSPQQISMTQ
QQIVVGGQRIILSPGQTIVTQRNVPQSQALQMVQQQIQTQQQQQQHHVVQPQQQFVVQSN
QIVQSSPSAQTKLVKQLVVQQQSQQTIEEKTQITTTDSNETGTQQVLVPNSTLAQQLAQG
KLQVATVNGQQVIVKPLGNNQAQIVAHIKHQGDGNAHIVTSNSATAVPQANPQTSPVKQQ
ALPPQSPQQVVVQQQQIHQQSPTNFESGVTPITQQPVLTQAVQAPAQQQALSVEESLLQN
QPPGTVIKCVTAQVLQTEHGPRIVLQGLVGNDFTAQQLQLVQTQVKQQLMKAQESNGKLG
VLGPTKIYLAVQPENAVQSQPPPLTPVHQSAAHQQTNNIEIDADTLATTYEANSTIKDIA
INNGDDQENSKCAETENSNITTNESFAGTSSLLEGSEHDEPTNLAGLDISETDLENKQNE
SFVVTRGYIQKSISNALKQGNLSPELEEKLVCMQKQQENANSTNEWETCSRGSVNEEALT
PSRQTDDTEWKIRTSLRRPNAMTTSSQFNRILKKNRSKNDEVAELGEQKQSQLERHKELL
KKNILRKRSLLERNLQSEIHEDVKTKVQRHVRPLSNASPDEQSENERSGEPNLDFKRTEV
QNPRHGAGRPKKLTRKKEKLYCICRTPYDDTKFYVGCDLCSNWFHGDCVSITEEASKKLS
EFICIDCKRARETQQLYCSCRQPYDESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVC
PECQRKNDANAANMKKLTSNDVEELKNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEP
MDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKESSFYKCAEALESYFVQKIKNF
RENVFDQRT
Download sequence
Identical sequences FBpp0072422 NP_728505.1.81976 FBpp0072422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]