SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072446 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072446
Domain Number 1 Region: 36-119
Classification Level Classification E-value
Superfamily RING/U-box 3.14e-34
Family RING finger domain, C3HC4 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072446   Gene: FBgn0040291   Transcript: FBtr0072547
Sequence length 122
Comment pep:known chromosome:BDGP5:3L:357981:358486:1 gene:FBgn0040291 transcript:FBtr0072547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEIEVEETEDFHDMDFNDEEPSCSGGAVQARTERFVVKKWVAHAMWGWDVAVDNCAIC
RNHIMNLCIECQADPNANQDECTVAWGECNHAFHYHCIARWLKTRLVCPLDNKEWVYQKY
GR
Download sequence
Identical sequences Q9NHX0
NP_652613.1.81976 7227.FBpp0072446 FBpp0072446 FBpp0072446 FBpp0072446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]