SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072607 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072607
Domain Number 1 Region: 129-323
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.77e-22
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072607   Gene: FBgn0035211   Transcript: FBtr0072723
Sequence length 330
Comment pep:known chromosome:BDGP5:3L:1333239:1335359:-1 gene:FBgn0035211 transcript:FBtr0072723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLFISRPTRTLGNRMQAVRERLGPDLADQLDALHRNVMRTGLVSTQELEEAFRKTRDMD
HNPNRLNLLWLLGIVFFIMVATPVFYETISFLLGVRCFLPNNYLVWEATRPISDCEFCKG
VRAPLILANLTMEEFAPHAYSSMPIIVKRAVAHWPAQKNLSFAFIKELYESVPGAMDSDC
QFLHFNSDLKSLKHVFSMSAERSNLTQGVPWFVGWSVCQPAVLAELRKLYPRPHFLPFDA
EMPHTDFILMGYEQGAVMHLDYIPRLLWQAQLSGNKTWFLAPAPECDHQCQPFSFYVEPG
DAVLVDTRIWYHANSIPKGQFSLTVQSEYG
Download sequence
Identical sequences Q8MSC8
NP_001261251.1.81976 NP_612102.2.81976 FBpp0072607 7227.FBpp0072607 FBpp0072607 FBpp0072607 FBpp0304250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]