SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072779 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072779
Domain Number 1 Region: 7-60
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000205
Family Variant RING domain 0.013
Further Details:      
 
Weak hits

Sequence:  FBpp0072779
Domain Number - Region: 595-605
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0152
Family Formin homology 2 domain (FH2 domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072779   Gene: FBgn0035333   Transcript: FBtr0072901
Sequence length 988
Comment pep:known chromosome:BDGP5:3L:2368014:2371939:-1 gene:FBgn0035333 transcript:FBtr0072901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLSQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSF
SFQPIYAPDMPRVLPIKDVLVGLMSAVLEGARCWLHYTLVGLAWFGVVPLSAYRTYRYLF
RASSFDMILTLPFDIFSVENLASDAFRGCFVVTCTLLSFIGLVWLREQILHGGGPDWLER
DDAPLQAAAANPAPDPAAEAAPQPQDDNNNADDNEAPAPADNDGQDAQAQDAAPAAAAPV
VDADADEQNWNPMEWDRAAEELTWERLLGLDGSLVFLEHVFWIISLNTMFIFTFAFCPYC
VGNFILSSMDLLQPEKPLLHFHGLITTLFGYCCIGLTLVVLHFFSRVFRLRRVCWFIGLC
YIVVKVSLLSVLEIGVLPLICGWWLDICSLPLLDASLKDRKESFKAAPGTSLFVHWMFGM
VYVYYFAAFVSLLREVLRPGVLWIFRNVNDPDFSPIQEMIHVPIVRHIRRLVASAMIFGF
AVLLMLWLPIRILQVVCPDFLPYALSGDSAVNLQLLLLQIVLPGFFEQTQTRIWLKGLLR
IWCTAVAWLLGIRSYLLPAPEPEPEIPAAGEEGVENAAGENENQEGEAADAAAQPPAPPP
PPPPPVEPAPAPRNLAAAHQAIMQRDAPVGFQPYDKPSLFALRLCALLALMCLSIVCAAM
LTLTVPVYIGRRLMLIWSSQPDEKAAGAAAAEGAGEVVENLDPIDPEGARKNERLLRSHE
LYTAELGGYLCWIVCRVVAAVVTLLPQGRAAIVDKIKHWVRVALQYALPVLTLLGIFVLV
PLLIGLLIELAVVIPLRVPLRKTPIHFLWEDWALGVLYCKIAIALTMMGPDWHLKRALDR
AYMDGLRDFDLKFVMRDLAVPVVTTIGLALAIPYVMAHMMFPIFLADAYAQHVVARLVYP
VSFIVVGSICILLFQIDQLKKLYLSIKVDKYLVGQRLVNYEHRKKQQQQQEEEKEQQRAA
RELRENQERDREREREQLVQELELAELL
Download sequence
Identical sequences Q9W023
FBpp0072779 FBpp0289997 FBpp0072779 NP_001163328.1.81976 NP_001286913.1.81976 NP_647715.2.81976 FBpp0072779 FBpp0289997 7227.FBpp0072779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]