SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072854 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072854
Domain Number 1 Region: 214-410,544-661
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.48e-60
Family Diacylglycerol kinase-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072854   Gene: FBgn0052484   Transcript: FBtr0072984
Sequence length 661
Comment pep:known chromosome:BDGP5:3L:3047087:3050159:1 gene:FBgn0052484 transcript:FBtr0072984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESLDKTTSPSSASSRATPPGTQDADEGHDVSDTFYTSQRKKGSHVFRVRLDATGFTLQ
RESPGGSIVKEQHVRISDIVGARCMRPKKSRRLAMSGACACSSGNPNSPAISASGDHHRP
ATTPSKCSTNSRDNIPSDGGDVSAFLYVFAYVLKKRSLRSELHRERTVLTLRFRSFDTFE
DNMREADRWYRSLRWQLHRTLEEIFVAPTVDERRRRVLVLLNPKSGSGDAREVFNMHVTP
VLNEAEVPYDLYVTKHSNFAIEFLSTRCLDAWCCVVAVGGDGLFHEIVNGLLQRQDWAHV
LPHLALGIIPCGSGNGLARSIAHCYNEPYFSKPVLGAALTVISGRSSPMDVVRVQLQSRS
LYSFLSIGWGLISDVDIESERIRMLGYQRFTVWTLYRLVNLRTYNGRISYLLTDHEVSST
HSATGYAAQRRMQSSRSCNTHIDMLNGPAPIYHSSAEYLPQEFADVISLETSINQSFRSR
CDSWLSGGSRRSFYYSISESIYHSLADESEFAGLAAASLENRQQNYGPASELPDLNEPLS
EDQGWLVEEGEFVMMHAVYQTHLGIDCHFAPKAQLNDGTIYLILIRAGISRPHLLSFLYN
MSSGTHLPESHDDHVKVLPVRAFRLEPYDNHGIITVDGERVEFGPLQAEVLPGIARVMVP
K
Download sequence
Identical sequences Q9VZW0
FBpp0072854 FBpp0072854 7227.FBpp0072854 FBpp0072854 NP_647762.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]