SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072874 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072874
Domain Number 1 Region: 179-253
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000000017
Family SIAH, seven in absentia homolog 0.0047
Further Details:      
 
Domain Number 2 Region: 107-183
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000121
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072874   Gene: FBgn0052486   Transcript: FBtr0073004
Sequence length 412
Comment pep:known chromosome:BDGP5:3L:3055908:3070839:-1 gene:FBgn0052486 transcript:FBtr0073004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVESSSSAVQQPPSSSNLPLLGDNQAVATTSSASSASSSSTSSSSSSVGGGNVVGVPLD
TQGSGEPPAKKQLLDGGGGGATSSSGSSLLSSAAAASGMHEKLAHRISNALCCAVCLDLP
KTAMYQCQMGHLMCAACFTHLLADGRLRDQIATCPNCRVEISKSTASRNLAVEKAASELP
SECQFCNKEFPYKSLERHEQHECQERPTKCKYHRIGCQWRGPYHETNEHERNCLHPQKSG
YEVMAALEAHDDRIKEEKKMFNTLIDLLSYEKIIFNDLQMKPYRTDEYVHKLFYETARFS
AFNQQWVVKARINNSQRDPHQSNERTITYQLILKTKTSTPMSIHFFALKGPFSDMKVSTQ
IYKHEFTETSTESEYYVLPLPDGVGGSGSSECNRMLANKGINFRLLMFLLNK
Download sequence
Identical sequences Q9VZV5
FBpp0072874 7227.FBpp0072874 NP_647765.1.81976 FBpp0072874 FBpp0072874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]