SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073027 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073027
Domain Number 1 Region: 100-147
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000376
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073027   Gene: FBgn0035479   Transcript: FBtr0073170
Sequence length 163
Comment pep:known chromosome:BDGP5:3L:3948699:3949305:-1 gene:FBgn0035479 transcript:FBtr0073170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLPKIVDLLKELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMS
LQQELGKYEYFTLLVRHIAQTHSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLR
CGHLFGRHCINNVLRESSRCPTCSRRARHHEVRRIYGLKFYPL
Download sequence
Identical sequences Q9VZK5
NP_647843.1.81976 FBpp0073027 FBpp0073027 FBpp0073027 7227.FBpp0073027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]