SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073100 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0073100
Domain Number - Region: 71-108
Classification Level Classification E-value
Superfamily RING/U-box 0.00671
Family RING finger domain, C3HC4 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073100   Gene: FBgn0035518   Transcript: FBtr0073244
Sequence length 840
Comment pep:known chromosome:BDGP5:3L:4255991:4259152:-1 gene:FBgn0035518 transcript:FBtr0073244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFNKAQAKNLAAAQKLVDTYASSSEDEGELDENHILELLYKNYKPSDNAGSSKEAART
STFLENTLHSGAATCLICIGSIRRVEAIWSCESCYCFFHLKCIQRWANDSMMQMKVKAAE
QQNGQGHYNHLGEFVPPKRQKSLHWCCPKCRRDYQPADKPTQYNCFCGKEVNPENQPFLV
PHSCGEHCGKLLQPKCGHDCKLLCHPGPCPPCAQQAQVSCLCGKSSPRSVRCIDKQWTCQ
QTCKELLACGKHKCNQVCHQPGKCPPCTSKSLQPCECQRESKMVNCSDRKWKCQNVCGAP
FACGLHICEKVCHAGPCGDGECPLQVRSCPCGKNTQVRPCNETEETCGDTCQKLLSCGQH
TCTQRCHRGPCISCPIRTKKKCRCGLHEKELPCSKEFACETKCKQMRDCGKHACNRKCCG
DQCPPCEKICGKQLSCNKHKCQSVCHNGPCYPCKLESQINCRCGKTKKSVPCGRERSARI
VCLELCRITPKCHHAIKHRCHKGDCPPCGQVCGLPNDTSKCGHICKARCHEAVRVNKPKE
ARPQAKKYEYKALPHPRCEEGVIVTCIGGHEVATWPCWNSKPTSCQRSCARQLKCGNHKC
SLVCHFVPLPQDMSAQTGCANCEEGCTVPRPTGCIHACPKGCHPPPCAPCNFVIKTKCHC
GLNQLVYKCNEYYDETGSVQEIIERREKLRSCGNRCLKNYPCGHRCTAICHTGKCPNPEL
CRKKVRIFCACKRLKQEIACDKHRAGQTFLDCDSNCKAEQIRVQAAEQLQLEQKRRDEEE
RNRLELEKFEAKFGKRKHKERKTVGSGPAKTKIDWQRRAIYAVSILTVVGAIVVAFYADS
Download sequence
Identical sequences Q9VZF2
FBpp0073100 7227.FBpp0073100 FBpp0073100 FBpp0073100 NP_647879.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]