SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073127 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073127
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily L domain-like 1.22e-26
Family Internalin LRR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073127   Gene: FBgn0035497   Transcript: FBtr0073271
Sequence length 454
Comment pep:known chromosome:BDGP5:3L:4094343:4102960:-1 gene:FBgn0035497 transcript:FBtr0073271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLTEEMVIARAKQSDLSLIKKLNCWGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFE
DCTKLQELYLRKNSISDINEIAYLQNLPSLRNLWLEENPCCERAGPNYRSIVLRALPNLK
KLDNVEVTQQEVEDALRGGGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSYPQHSP
PPQQQYQQQQQQQQQQQRGCTTPTKEPPQLPSPLVKNSSEGSISHSASDLYQVQAAQPLK
GSQPPTPTKEPVHPPSPMYNTITKEQRTSYHQYDRSPGSDQESSPHTYREVRPTPFPPSI
SAHSMKEYYQSDRPAYPAHYRHSQTDLTEWEEHQQVPQVHHNPYGSQKQLHQPQRRSAGP
EMTPYRNGSARENGGEWDPEDRSRARRPEGRYSDGTSSLSASVMNHYSGYHRRPINRNSN
ILSAALCLVKELDYASLEVLEHAVRCRIDELANE
Download sequence
Identical sequences Q9VZI4
FBpp0073127 NP_728935.1.81976 FBpp0073127 7227.FBpp0073127 FBpp0290099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]