SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073195 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073195
Domain Number 1 Region: 31-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-72
Family FCH domain 0.00000047
Further Details:      
 
Domain Number 2 Region: 566-627
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000328
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 375-446
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000955
Family HR1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073195   Gene: FBgn0035533   Transcript: FBtr0073339
Sequence length 631
Comment pep:known chromosome:BDGP5:3L:4323530:4364102:-1 gene:FBgn0035533 transcript:FBtr0073339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALLASGSSRSSSNNKLAESENSAQNSNNMSWGTELWDQNENLAIHTNRGIDALDKFAN
FLRDRVAIETEYAGKLRRLVKNYQPKKKEEEDNEFTSVQAFRNLLKEVGDLAGQREVVSE
SLQLQIIAGVTLLSKTLREERKKCLSDGATLQQNLTTQLSSLDRAKRNYEKAYRDSEKAV
DSYKRADMDLNLSRAEVERYKNVMTSKIQQSDDAKNEYANQLQKTNNLQQQHYSMLLPSV
LNRLQELDEKRTRGFREFIVGAADVESSVAPIIARCMEGIVKAGESINEKEDTFKVIERY
QSGFTPPRDIPFEDLSKCDPDSVQDSHYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSN
KNSLTADGQKEDFSDLPPNQRRKKLQAKIAELTQNIAQETKARDGLMKMKIVYEANSSLG
NPMTVEGQLNESEHKLEKLKVDLKKYQGFLEKASQVPTATSSPQASRNQLQNGHRTSRHS
NGSADDHHDDGDDQPDDAGSLSRSDSEDNVAQIQNGHNNNNNGSASPESGLGTSHTSLPG
SGQGSANENAIGEDTYYETEVETLNPVGKCRALYPFEASSEGSIPMSEGEELQVIEIDQG
DGWTRVRRENNSNGWDEGFVPTSYIEITLYA
Download sequence
Identical sequences Q9VZD7
FBpp0073195 FBpp0073195 NP_647893.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]