SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073214 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073214
Domain Number 1 Region: 218-244,440-638
Classification Level Classification E-value
Superfamily L domain-like 1.47e-31
Family Internalin LRR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073214   Gene: FBgn0035577   Transcript: FBtr0073358
Sequence length 1301
Comment pep:known chromosome:BDGP5:3L:4829092:4833591:-1 gene:FBgn0035577 transcript:FBtr0073358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKCRGRSILNDETPTPEAACPAPGPAPAATPAAANPLPHPQQQQLQQQQNYLPQTSLLK
IEPFVPSFNQRLRRRPIGRSHSTLSHNVISKRPVPQQHQQQQIQQPSELQVGQQQQLKRG
YAAAAQIRQQQQQQQRNLPRGVGIQRQRSKSTSSSAASNSCRPATAAVTPNTLVGSTGGT
LVSGAIVTPQPNGICRIQRLPKEREELPDRINYDKRGLTAIPIFEQEPNLRLLSLQHNLI
NTFHIPKEVTPPPPPVPPPAVATPRESNNNKLGEYSNGNGNKEGGRSGLRGHHPGRLTRA
MTNAGGNSHRLSPKSGGSPGSGSPLTTQALAINGGTAAGRSKLAKRGYNYGQAQLTPPPA
LRMRYGLEKSKSFVSSSLQAMKHQQQLIQRRAMLKATRAGGVVAPGGAASNLLQSCDEGS
ALHNSNLSLYGGCGEEEESPSVMTSISALEQLSIKNKQLSLSASYGSIFQQLVFLDLYDN
QIERIANLDGLPSLSVLLLGKNRITDIGGLSSLKDTLRVLDLHGNKLTSLGSRINCLQQL
KSLNLAGNQIRQINQQDFLGLRCLRELNLKRNKLRRINGFQHLVALERLWLCHNDLHRVD
DMASIARATRLLEVTIENNPVSLAGDCVSFLVSYLPLLQTLSQMPITEQVRRAALAWRQH
KEQAQAAPGSSEAYHNIRREEVISNARTNWELLRSQQTVVGRPKSRLTSELAKINESNEG
PAGEEGEMESEESQQPKELMDELQALIKLPPIAKDLRNPHEEDGASSEASSLGPNVDSCS
SCYSSDNEDGGAKNKPQTPQIDENSNKVGLTEKPPSSPVTVASQSPEVAIVTPSAPVSSS
PSPPALTLTPPAAPGTPVPGTTSPSPSTTIISTLPVPATASSNASRPTSSKQRSRHAPIT
QLGLQINQRGGAAASSKRYMAGSLVRAQTVSSSTSNSSSSNSAGRGKATNNGLNLVATQT
KAATSGNNQSSAGAAAGTGGSTTAAPPAGAAATPNAAITVSKPSAAEREREQGGDYLIEI
CGRYLNIYGQGALRFIDKQWNPAKANDVHTLNFSYINFNSIVCVLGRIKLRFPHAEHYVF
RETNISCLGQLNGLAELQGLSSLMIDAEGNGITLKETWRAYAIYRLSHWGLKQLNGQEVT
EAEVEAANAMYVGLSDLVLWSMPEVMLQPLLARLRLDETCTASKLSPKEWLLRPDNKSLR
LVVGKEALQWKKNAGGGAGTSTSMNINQGTEAGSTAMAPSVRDRGRQHFALLLENTCNAV
EKLHKLETLWPSMLLDIVRNTLLDYAQLDVYLRNLMCELLK
Download sequence
Identical sequences Q9VZ81
7227.FBpp0073214 FBpp0073214 NP_001261433.1.81976 NP_647933.1.81976 FBpp0073214 FBpp0304985 FBpp0073214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]