SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073218 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073218
Domain Number 1 Region: 152-539
Classification Level Classification E-value
Superfamily L domain-like 7.18e-63
Family Ngr ectodomain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073218   Gene: FBgn0035575   Transcript: FBtr0073362
Sequence length 615
Comment pep:known chromosome:BDGP5:3L:4803077:4805274:-1 gene:FBgn0035575 transcript:FBtr0073362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGVWQLVSLVLLMDPAEVITGPSQAKEPPIQSLDEFRQRYLLPLISSDTRNCSLNACE
SLGIVSQLLMLINSMPNGTQSAANDKKPPKSKANGHNDGDVNGGEINAMSHLANFDLVKR
VRQIESRLRSVEQPVWHLATGSQIEWNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIP
MNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQ
LEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQ
LMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNR
ISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNV
SALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNK
LMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLG
GHEVGLLRYDDLCDGQWASMLSLSPRLPVRKHQISTPMNYTDYFNLYLKHIYNGTTDEEL
KEADITSVSIKKVHN
Download sequence
Identical sequences Q9VZ84
FBpp0073218 FBpp0073218 7227.FBpp0073218 FBpp0073218 NP_647931.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]