SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073267 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073267
Domain Number 1 Region: 364-540
Classification Level Classification E-value
Superfamily NTF2-like 9.56e-49
Family NTF2-like 0.0000554
Further Details:      
 
Domain Number 2 Region: 198-347
Classification Level Classification E-value
Superfamily L domain-like 1.46e-26
Family mRNA export factor tap 0.00037
Further Details:      
 
Domain Number 3 Region: 607-672
Classification Level Classification E-value
Superfamily UBA-like 1.63e-21
Family TAP-C domain-like 0.0026
Further Details:      
 
Domain Number 4 Region: 100-193
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.44e-21
Family Non-canonical RBD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073267   Gene: FBgn0003321   Transcript: FBtr0073411
Sequence length 672
Comment pep:known chromosome:BDGP5:X:10726785:10741125:-1 gene:FBgn0003321 transcript:FBtr0073411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKRGGGSSQRYNNNVGNGGGRYNAPEDFDDFDVEDRQRRKDRNKRRVSFKPSQCLHNKK
DIKLRPEDLRRWDEDDDMSDMTTAVKDRPTSRRRGSPIPRGKFGKLMPNSFGWYQVTLQN
AQIYEKETLLSALLAAMSPHVFIPQYWRVERNCVIFFTDDYEAAERIQHLGKNGHLPDGY
RLMPRVRSGIPLVAIDDAFKEKMKVTMAKRYNIQTKALDLSRFHADPDLKQVFCPLFRQN
VMGAAIDIMCDNIPDLEALNLNDNSISSMEAFKGVEKRLPNLKILYLGDNKIPSLAHLVV
LRNLSILELVLKNNPCRSRYKDSQQFISEVRRKFPKLVKLDGETLEPQITFDLSEQGRLL
ETKASYLCDVAGAEVVRQFLDQYFRIFDSGNRQALLDAYHEKAMLSISMPSASQAGRLNS
FWKFNRNLRRLLNGEENRTRNLKYGRLACVSTLDEWPKTQHDRRTFTVDLTIYNTSMMVF
TVTGLFKELNDETNNPASMELYDVRHFARTYVVVPQNNGFCIRNETIFITNATHEQVREF
KRSQHQPAPGAMPSTSSAVTSPQAGAAAGLQGRLNALGVATGPVAILSGDPLAATAPVNS
GSAAISTTAVAPGAQDESTKMQMIEAMSAQSQMNVIWSRKCLEETNWDFNHAAFVFEKLF
KENKIPPEAFMK
Download sequence
Identical sequences Q9U1H9
NP_524660.1.81976 7227.FBpp0073267 FBpp0073267 FBpp0073267 FBpp0073267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]