SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073346 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073346
Domain Number 1 Region: 189-390,521-639
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.72e-61
Family Diacylglycerol kinase-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073346   Gene: FBgn0030300   Transcript: FBtr0073497
Sequence length 641
Comment pep:known chromosome:BDGP5:X:11336572:11340045:1 gene:FBgn0030300 transcript:FBtr0073497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTANTGTSGENLMGNGGKTHEPSTPTSDTEVASGTPTELSEIFFVDNSRRKQSIKIQVKL
CPEGVYLRRETEEDDHINEQLIRIDDIIGSRYGRRLKKRARGGLNSCRNPNVPGQEADSE
PDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYGVNLQTAEMWHHTIRKHKRGNG
SSSPADCGKQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRT
RRDLLTRYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPLGIIPCGSGNGLAKSVAHH
CNEPYEPKPILHATLTCMAGKSTPMDVVRVELATRDKHFVMYSFLSVGWGLIADIDIESE
RLRSIGAQRFTLWAIKRLIGLRSYKGRVSYLLGKGKKEPPVEAARELPAESTAAGIRSSL
PLNAGEFHDLPEEEEGEAVLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYSLGGPS
MRSNRSRMSISQRIEAANAEFAERVPTGTIPPLQMPLLSSDGWICEDGDFVMVHAAYTTH
LSSDVFFAPESRLDDGLIYLVIIRRGVSRHQLLNFMLNLNAGTHLPIGEDPFIKVVPCRA
FRIEPSSSDGILVVDGERVEYGPIQAEVMPGLINVMTTSGQ
Download sequence
Identical sequences Q9VYY8
FBpp0073346 FBpp0073346 FBpp0073347 7227.FBpp0073347 FBpp0073346 FBpp0073347 NP_572717.1.81976 NP_727528.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]