SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073433 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073433
Domain Number 1 Region: 448-876
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.68e-73
Family Tandem AAA-ATPase domain 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0073433
Domain Number - Region: 98-165
Classification Level Classification E-value
Superfamily RING/U-box 0.0706
Family RING finger domain, C3HC4 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073433   Gene: FBgn0030354   Transcript: FBtr0073596
Sequence length 1180
Comment pep:known chromosome:BDGP5:X:11794470:11799373:-1 gene:FBgn0030354 transcript:FBtr0073596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDTYAPSSALSFLDMDDNELLPGADTQPTQYDYRDFTMPSTSQSQTQNDQLEIAQRCS
AGDSHPRLASITNDLADLQFEEEDDEPGSSYVKELPPHACKYCGIHDPATVVMCNNCRKW
FCNGRGSTSGSHIINHLVRAKHREVTLHGEGPLGETILECYSCGVRNVFVLGFIPAKADS
VVVLLCRQPCAAQNSLKDMNWDQEQWKPLIADRCFLAWLVKQPSEQGQLRARQISAAQIN
KLEELWKENIEATFQDLEKPGIDSEPAHVLLRYEDGYQYEKTFGPLVRLEAEYDQKLKES
ATQENIEVRWDVGLNKKTIAYFTLAKTDSDMKLMHGDELRLHYVGELYNPWSEIGHVIKV
PDNFGDDVGLELKSSTNAPVKCTSNFTVDFIWKCTSFDRMTRALCKFAIDRNSVSNFIYS
RLLGHGRADSNDEVLFRGPQPKLFSAPHLPDLNRSQVYAVKHALQRPLSLIQGPPGTGKT
VTSATIVYQLVKLHGGTVLVCAPSNTAVDQLTEKIHRTNLKVVRVCAKSREAIDSPVSFL
ALHNQIRNMETNSELKKLQQLKDETGELSSADEKRYRNLKRAAENQLLEAADVICCTCVG
AGDGRLSRVKFTSILIDESMQSTEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAARAG
LSQSLFERLVVLGIRPFRLEVQYRMHPELSQFPSNFFYEGSLQNGVCAEDRRLKLDFPWP
QPERPMFFLVTQGQEEIAGSGTSFLNRTEAANVEKITTRFLKAGIKPEQIGIITPYEGQR
AYLVQYMQYQGSLHSRLYQEIEIASVDAFQGREKDIIIMSCVRSNERQGIGFLNDPRRLN
VALTRAKFGIIIVGNPKVLAKQQLWNHLLNFYKDRKVLVEGSLNNLKESLIHFQKPKKLV
NSMNIGAHFMSTIIADAKEVMVPGSIYDRSGGYGQGRQMVGQSMNGGQYGGSGGGPYGNS
PLGYGTPSSNSMVGFGLGNGGNGAAGGNNNFGGAGPSWAAAHLHHDSIGYISNEHGAAAL
GNMPVPVGMFMNMSNIPPRFYNQHQQAIMAVKQNRAIQQQTGNFSPGNSGPGVTGVGVGR
SATPGGNKKTNKLGKSRVTGGGTGGAPLTQGSSVCNAAPYSQHPMPLSLQMTQPSGFALS
QQPELSQDFGQISQMDGLLSQDVAFNASGERSLNQFSQPY
Download sequence
Identical sequences Q9VYS3 X2JBC1
FBpp0073433 FBpp0073433 NP_001285145.1.81976 NP_572767.1.81976 FBpp0073433 7227.FBpp0073433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]