SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073495 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073495
Domain Number 1 Region: 526-602
Classification Level Classification E-value
Superfamily RING/U-box 3.75e-22
Family Variant RING domain 0.0000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073495   Gene: FBgn0030400   Transcript: FBtr0073662
Sequence length 615
Comment pep:known chromosome:BDGP5:X:12463784:12477215:-1 gene:FBgn0030400 transcript:FBtr0073662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQTKRQHCYLCDLPRMPWAMINDFSEAVCRGCVNYEGADRIEAVLDAARQMKRLHPAS
KQQRSHENGEVSAAAAAAVVLQQQQQLQVGPVPGQGPGSHRGGGGGGPPGAPPGSGGPGP
SGAGSLSSLGNAVAAAAAAAAVHHHHQMPYQMPVPRIGPPLDYPVKLEDAPGGGVRPVRI
SHMTPHHLPPNATRGGGGAPGGGVPTAGSGGGSLPPALSVNLKRPPSEDVDVDVSQQQQQ
SGHGLAPDGSAGNSLSAGGGVSGGCPPGIKRSAMDDPSGVGGRPPLTRGESLPAAVSYVP
ERQLSGLRDKQQPVRAPSFDASTFKAEHMSPASRRNGSSPPSGPLPPRSVHSPNSSGSSS
GRRSSGSRHVSSTTVTSSEVGGSNPGQAVVAGGLGGGGGGGPGSNAASGQLGGPSGGSGQ
LSCTSGGPGGSASSGSGGNGAIGPASMAPNSVAGDGSPAGGNGPSGSNGSGGSVNPGPGS
SGSQGGGGGGTPLASGGGSAGSGGLGGAPGSSAASNSAAAAAAAAAQNATLKCTLCQERL
EDTHFVQCPSVNHHKFCFPCSRESIKRQNGLGNEVYCPSGDRCPLANSVIPWAFMQGEIT
TILGEEVKVKKERES
Download sequence
Identical sequences Q9VYL7
FBpp0073495 NP_572809.1.81976 FBpp0073495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]