SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073517 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073517
Domain Number 1 Region: 144-176
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000102
Family CCCH zinc finger 0.00028
Further Details:      
 
Domain Number 2 Region: 104-139
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000157
Family CCCH zinc finger 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073517   Gene: FBgn0011837   Transcript: FBtr0073684
Sequence length 408
Comment pep:known chromosome:BDGP5:X:12553395:12573735:1 gene:FBgn0011837 transcript:FBtr0073684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDHLGDFDCNEVRKEIRMLLAHGANLDQQHQQQPHRHHGGLTRTISQPAQLIQQQQQQH
QQQQQQQPAVASLVTITENLGNMNLHRKLERTQSEPLPPQQPMNTSRYKTELCRPFEEAG
ECKYGEKCQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQA
AQAAKSSTQSQSQSQQSSSQNFSPKSNQSSNQSSNSSSSSSSSGGGGGGGNSINNNNGSQ
FYLPLSPPLSMSTGSDRESPTGSLSLSPTNSLTSFPFHDALQHGYLASNGAKSNSSASST
SSASGMGLGMSMGIGQGMIIGQGLGMGHHGPATPPESPNVPISPVHTPPPYDVVVSGSGA
GNNSVGSKQLLQKSVSTPMQQEDTPRLPVFNRLSSGVEAYQQQSNLGL
Download sequence
Identical sequences FBpp0073517 FBpp0073517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]