SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073674 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073674
Domain Number 1 Region: 302-367
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000053
Family RING finger domain, C3HC4 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073674   Gene: FBgn0030514   Transcript: FBtr0073843
Sequence length 789
Comment pep:known chromosome:BDGP5:X:13612767:13616058:-1 gene:FBgn0030514 transcript:FBtr0073843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNFVSRQNAAVEEADPSTNNAYKYPPRMGNFFGTHFIMGGERFDTPQPESYLFGENADL
NFLGNRPTAFPYPPPQANEPTKTLKSLVNIRKESVRFVKTMNDKKLGGVLEKPKMKEIDR
DLDLDKEKSNVTIEDVDGNVLCSMGLGGGDADMTPPPPPCSYNIEFTFDSDAKCAITIYY
FCSEDVSPSGVTLVPREGLTSETYHYEKGINQCFSQPSHVFNPQQMPEDELGYSPGREQY
PVAIHCVVEEGSDECRQSHTTICVIDHHPENGSYVLRALKQKIFVDGLCYLLQEIYGIEN
KAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANNCPICRAP
FRALLQIRAVQKGISTHVLHQNTPTSAAGEPAPVDVPPGYIPVSLIEALNGPPQYVARAR
NSEHDVTDSAATVAASTMTSADIKATSPIKSSSQRRPKIKKNASTCTSTSEVGTITNQSG
GGNGSSTHSVEIESDPKKSSTATCTSPTLGASTSPEPKQDKLQIVNERKYPRSTAGSGGD
GSAGTDDDVDSENEKLSPLLSPGSKSKNVSSKSLKQVVACLEADDDVDNKSSTGDGPTEE
SSLKKGSSIKRTKPRPELSGSGAPSPAEATAEDSDYYTPEDTQNSILSPLCPTERAKSGD
PLGAGSLGNGGLSVGRSAGSVGGQAGVGPVVVGFSSAVKKNLHKKSTSVGNMVGSGSVTT
VVDLKSNNVSSLPDMLDSPISGNSASTRSSSDSYSSSSSTKQLLSSNPTTTAANIIVDDK
TALQNAVNV
Download sequence
Identical sequences Q9VY98
FBpp0073674 FBpp0073674 7227.FBpp0073674 FBpp0073674 NP_572915.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]